SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0HGA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0HGA0
Domain Number 1 Region: 166-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000981
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R0HGA0
Sequence length 308
Comment (tr|R0HGA0|R0HGA0_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA28709.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10024937mg OC=Capsella.
Sequence
RIEKKMDNSDDARVVSHSKLEMLLYVAAMVYDQEYGTHAEDRSKTIGEVETEVEARIFGG
SVPRKSRSRRSSSSRKMVTTPWTRVIERQRSELQNPNAESEPSSSSCVTQIKKRRHDQID
VEERSRKKLKKTVRGLEVEPIQTSPPEWLLNVMRREENGYNPKLISTRKLYQTDLDKLQA
RLSVPFRQVKNHDFLTEQETIVIHENAMKTREEGVSVDLVDPEMKKHALELRKWKMVGNW
NYVLCKGWKNVVSANRFEVNDVFPLWSFRSGRGKLCFALVPPPTASDGASTSGESSHGCS
SFDDSPHL
Download sequence
Identical sequences R0HGA0
Carubv10024937m|PACid:20902477 XP_006295811.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]