SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0IR51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0IR51
Domain Number 1 Region: 145-412,444-491
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.42e-78
Family IF2B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0IR51
Sequence length 513
Comment (tr|R0IR51|R0IR51_SETT2) Uncharacterized protein {ECO:0000313|EMBL:EOA87375.1} KW=Complete proteome; Reference proteome OX=671987 OS=(Exserohilum turcicum). GN=SETTUDRAFT_171549 OC=Pleosporaceae; Setosphaeria.
Sequence
MSEAPVAQPAPAPAADSPAPAASVPAPGEGTSDAPKKLSPAELKKLKQAEKQAKRAQAKA
TGGAPNQQQGPSKDSQKQQKDSKQTSKDEKSRPFPTRQKPAQAHASLAKEPEKKSKKDAG
SKQTGLFFGHLYSQPKQQSLVGASKDVHPAVLALGLQYSSYAICGSIARMVAMLLVFKTV
IEAYQTPPGNSLARHLTSHHLGPQIEFLKSCRPLSVSMGNAIRWLKDVIIKIDPSTPENE
AKRDLIEEIDIFIRERVTAADRLIRDLAATKIQAGDVIMVYAASSIVEQTIVHAHDSGIP
FTVIVVDSKPLFEGKQLARKLANRGITVRYYLVTGASHAVRDATKVFLGAHAMMSNGRLY
SRVGTALISMLAHSHSIPVIVLCQSVKFTERVALDSIVGNEVAPAEEMLSEAERRELLPL
KSRLPASKTDDKSATAEDAPADTADVLKWIEEAKNLHHLQVLYDVTPAHYINMVINEYGS
LPPSSVPVVHRLRTEEQEVAPSKKGVRQTTGWS
Download sequence
Identical sequences R0IR51
XP_008025799.1.61199 jgi|Settu1|171549|estExt_fgenesh1_pm.C_2_t20272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]