SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0LF60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0LF60
Domain Number 1 Region: 11-132,538-697
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.01e-21
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0085
Further Details:      
 
Domain Number 2 Region: 407-487
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.000000419
Family Group II chaperonin (CCT, TRIC), apical domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0LF60
Sequence length 715
Comment (tr|R0LF60|R0LF60_ANAPL) Bardet-Biedl syndrome 12 protein {ECO:0000313|EMBL:EOB04284.1} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_04709 OC=Anatinae; Anas.
Sequence
LAMAFRDVNSRRHIGLQQLSSLASAGRTLLGPMKSCKFVVDESTNQSMLICSAVRLIESL
DLSSAAGQLLNETIQAQNKEFKTGMSTLLFLVGAWSNAVLECLQQNVPVSAIVSAMSEGL
NSCCEKVQCLQRSVHDVNKELCSSSVRPNTSSSKTYEVACDSFLNPQIFLCLQKEVSPSK
ELVPRNSCSRQEADSNLNKGLVLPLAGFGSIASPVRSADGNNASVISGSGVSASSCKQKR
LTHSRYFSALATSPSSSQLDDSQVCLSGQSAHPCECYGLGHLARALSHGNEPNMKLLKSI
VAYQHERAECSGSSQFNIAEVVTCCLPGLPESYSCVCPGFVTLVSPEQATVIKHFGDKPL
QILLMEGDLTEAYRHLGFTKPRNVRTVLERPDLQEGRPGDVWLNTSLDILMRSQVSLVLV
KGHVCENLLERCVANKILVIGSVPQKVLSAFGEASGAQPVTYLTQLSASCVGSGAQLELW
TASDGRAMDLGELVPVRIRVRGLALLTAVLTTAVPAKMQLVEDRFWTFVYRLHHALRDGK
VFLGGGAVELLCLSHSQALAEQALKLVNKKPVKEFHSPWLAASSAQYKPVVLQALASGWS
QYLAAVMCNTAKATSLFEARTLIEHHLKKAADCGSPSAYVLKEFQTGGTFRGGPVPSTGS
AEGCRVYDNVTAKTEAWRRALDLVLLVLQTDAEIISGPQSNQLLNSPASSEFMFL
Download sequence
Identical sequences R0LF60
ENSAPLP00000000691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]