SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0LH84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0LH84
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-56
Family YWTD domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 615-870
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 314-544
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 917-1189
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-37
Family YWTD domain 0.0000735
Further Details:      
 
Domain Number 5 Region: 1320-1356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 570-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1241-1281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 873-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 268-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1199-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0LH84
Sequence length 1600
Comment (tr|R0LH84|R0LH84_ANAPL) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:EOB05004.1} OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_07867 OC=Anatinae; Anas.
Sequence
ASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDVSEEAIKQT
YINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSRKVLFWQDL
DQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLY
WADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEK
RREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLE
DDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWT
DDDVRAIRRAYLDGSGAQTLVTSEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR
KILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLAL
DLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIER
VHKIRASRDIIIDQLPDLMGLKATSVAKVFGTNPCAENNGGCSHLCFFTPQETRCACPIG
LELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIY
WTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQ
YRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLT
IDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIER
ADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAA
HYTLDPNSRNCSSPTSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDKL
IYWVDGRQNIIKRAKDDGTQAIIRSHSLYVVLQPFTVMSSPNQSQNPEKQPHDLSIDIYS
HTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIER
AALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNIL
QPMGLTVLGNHLYWIDRQQQMIERVEKTNGYKRTRIQGRIAHLTGIHAVEELDMEEFSAH
PCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIP
MAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTL
CLPNQFRCASGQCILLKQQCDSFPDCIDGSDELICEKTKPASDEPQPHSSAIGPVIGIIL
SLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGK
SMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEM
FYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPP
PPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences R0LH84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]