SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0LP48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0LP48
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-42
Family Forkhead DNA-binding domain 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0LP48
Sequence length 118
Comment (tr|R0LP48|R0LP48_ANAPL) Forkhead box protein L1 {ECO:0000313|EMBL:EOB03520.1} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_10717 OC=Anatinae; Anas.
Sequence
QDPPQKPPYSYIALIAMAIKEAPEQKVTLSGIYQFIMDRFPFYHDNKQGWQNSIRHNLSL
NDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKAAGPPEARSGAVPPD
Download sequence
Identical sequences R0LP48
ENSAPLP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]