SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0M3N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R0M3N5
Domain Number - Region: 9-52
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0102
Family SAM (sterile alpha motif) domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0M3N5
Sequence length 499
Comment (tr|R0M3N5|R0M3N5_ANAPL) NGFI-A-binding protein 1 {ECO:0000313|EMBL:EOB07268.1, ECO:0000313|Ensembl:ENSAPLP00000012385} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_10023 OC=Anatinae; Anas.
Sequence
MASALPRTLGELQLYRILQKANLLFYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMAS
KPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPAWLGISCSSYERNSST
REPHLKIPKCAATTCVQSVGASKSDVVGSLSLQSGSEPRLWQGHHTTESEHSLSPADLGS
PASPKENSETLDAAAALSVAECVERMVPSLPKSDLSEVKELLKTNKKLAKMIGHIFEMSD
EDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFAL
ARQISREVTYKYTYRTTKSKCGERDELSPKRIKIEDGYPDFQDSVQTLYQPDKMPLALAK
GKSEDSAALNSQSEKVMAKQMELLCSQAGLERRLSAGCYRQNSEEHSPNGMSLDNLDGQG
ERPLNLRMSNLPSRQLQHISLDGEQHVGKPLCSELIRLYPGGEAKSQSSEGLGILKDFPH
SAFNNIERKVIKTEPEDTR
Download sequence
Identical sequences R0M3N5
ENSAPLP00000012385 XP_005011475.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]