SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1B868 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1B868
Domain Number 1 Region: 39-155
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-21
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1B868
Sequence length 162
Comment (tr|R1B868|R1B868_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD05828.1, ECO:0000313|EnsemblProtists:EOD05828} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_417097 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MTDYTPKAAQDKQVNHGVYVQPTEDGNFGLDKDIADNAKKKYDFAKEQEVRTWIEKVGVK
LEDGLGALELQKVLQSGVVLCQLANKIKTGVCKLPRSTTQPAVQRENISFYLEACKKLGM
TDNFIFMTDNLFQDRLVELAMMSVINNLCELKNIAEKSSPAA
Download sequence
Identical sequences R1B868
XP_005758257.1.92643 jgi|Emihu1|417097|estExtDG_Genewise1.C_880028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]