SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1C9R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1C9R5
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000615
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 
Weak hits

Sequence:  R1C9R5
Domain Number - Region: 172-206
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0217
Family Trimerization domain of TRAF 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1C9R5
Sequence length 207
Comment (tr|R1C9R5|R1C9R5_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD19017.1, ECO:0000313|EnsemblProtists:EOD15384} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_66448 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MDDDELQRIYTWVDEVPLSRPKRNIARDFADGVLTAEIVHHYFPRIVEVHNYPSANSYAQ
KMYNWQTLNARVFKKMGWQLRQEELDAICSCQPQAVERMLKQLQVRLSKYGSRSKEEEAA
PQRPHAQATPRSAAAPPRRVGGLAGGAQVGLRDGAVQELLAEKDQNISELRETVEILEIK
IQKLEQLVRLKDSKIATLQGKLQKYEP
Download sequence
Identical sequences R1C9R5
jgi|Emihu1|66448|e_gw1.48.26.1 jgi|Emihu1|78461|e_gw1.3869.1.1 XP_005767813.1.92643 XP_005771446.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]