SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1CA93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1CA93
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-27
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R1CA93
Sequence length 207
Comment (tr|R1CA93|R1CA93_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD19588.1, ECO:0000313|EnsemblProtists:EOD19588} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_209209 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MPLNSGALLGWCQRETATYDGVSVENWSRSWNDGLAFCALLHRHFPDDIRFGSLNSSTPQ
SRARNFELAFGVAERRLDVERLFDVEDMMATYPRPDGRSVTTYVVLLYNAIEERGMVAAT
PAVQLTPLPLPDRSEDDSALSPAELAMIRKCNQKMEALNAKLQHSPRSHVPTAEEQAMLL
SMAALNAALESDARNPARPRYGFMTTR
Download sequence
Identical sequences R1CA93
XP_005772017.1.92643 XP_005786416.1.92643 jgi|Emihu1|209209|gm1.3700261 jgi|Emihu1|252978|gm1.151700002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]