SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1DCS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1DCS4
Domain Number 1 Region: 491-582
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000051
Family Anti-sigma factor antagonist SpoIIaa 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R1DCS4
Sequence length 712
Comment (tr|R1DCS4|R1DCS4_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD08641.1, ECO:0000313|EnsemblProtists:EOD08641} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_453061 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MAFLLDIAPIFGWLRDYPVRSALAHDISGGVTLGCILIGQSLAHAKLCGVELIIGPYSCM
LGPVLYAVFGTCIHSSIGTGALICLLVGEVLVEHGDSVEERSRIAPFLTILVGVILTLMG
VCRLSGLVRFLSRPALSGFITASALLAMLSQVSPMLGLPDSAGSIQKVLLHQPERLLAVK
WPTLLLSAVATGYLLSAKRLKQHPRLKPLGDFKELVLLGLGAAFCAAWDPPGLSQAECVE
HPLCVKVVGRIEPGLPHAHWPRVGAGDWGLIHSMLPGACLVALVAFLTSFAGAKKFGLED
GYQIKPFNELIAIGMCNVGGALLGAVPTSIGNTRMGIARQCGVQSQLGANVFVSIFIALA
VQFFTPCLFYIPMCALNAIILIGSSHMLEFAHAGYLLEFARHKEFGRDGRMDVLVWIVGF
VSTLFLGAFKGIISAVVLSLLIIVVNPHIALLGRQQEPPQSGVPHQPPRFRHRWVNMRGQ
RASGGLVATAVEEEPGVLVFRFEGPLFYANVDQLQEWLEAEELRRIEESPVDYEFKAIIF
SAIAVPFLDTTAIGALQTMIRSYADRNVLFLIANTFANTRRIVAETLGADQRRALREDLR
PRLASCTTVDDFVELVHANRALSKERPRPLIRTTSSLLSLASLASLNATPPKGTLADRQW
PLQRRPFSLACDRTPDAEMGRFTASTPALLSLARPITPRDRAAAGRARPFDR
Download sequence
Identical sequences R1DCS4
jgi|Emihu1|453061|estExtDG_Genemark1.C_730183 XP_005761070.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]