SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1DF33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1DF33
Domain Number 1 Region: 30-98
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000378
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R1DF33
Sequence length 98
Comment (tr|R1DF33|R1DF33_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD07379.1, ECO:0000313|EnsemblProtists:EOD07379} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_258642 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MTDTSWTTKTAAAQDTRPVSSAVHTGYDAAEKTEDGIPLYGMDKELAAKAAAKRDPKKEQ
EAREWIEALTGMSLDGTLQEALKSGIVLCALATAIKPG
Download sequence
Identical sequences R1DF33
XP_005759808.1.92643 jgi|Emihu1|258642|gm1.796400001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]