SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1E3A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1E3A9
Domain Number 1 Region: 536-623
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000163
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1E3A9
Sequence length 901
Comment (tr|R1E3A9|R1E3A9_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD15429.1, ECO:0000313|EnsemblProtists:EOD15429} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_211646 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MLPGSMKEPLVSKGETTVVKSKLWFGYLPLWQETVPLHPNGKIDTVRLIANIMAGLIIGI
RQTLSAIVSATLVFTTTSNQTVVDMFPFGISMMWWSTVAGTVWYGIFGRLQYNTSATQEV
CAILYGAMAGKAATFLEDTPDKIPPTVLALIVTGTILTGFGTVAFGKLGIGKMMLSFPTP
VTNGFLGTIGFFLVKQALQITSGVKFVHFYPISFSAFFAMRSVLPLLCLFAMVMVMRKGP
RLLGSAFPKSKAVKKLGGLFCQLSPLFVFYIVIGIGRMDLDTLGEAGWVYPAQAPQSFTT
LWTTYKLSDADWGVVAACVPDFGSLVLMSALCTMTGVLGITGKFPTGPDGDPAPDEGADF
DMELATVGVGAVFTGLTNGVVTFHRLGSSIQIRMDGGTHRIAVFSSAAFVGVFFFSGIPL
GHYIPKFFLGGLFMSSGVSFMESVIFSYQSMASSGLTLFGSDVPTWEYFGSLLCIATAAY
TSPLGGIAAGLLVSVLSFLASSSSSTPVSSVSDGRFTMGRTFRPIWELKALRTYGDRIAI
LYLQGQLFFGSGQRLASLIAEAVESRHHLSYCILSFAKVSGMDVSAVDFLRSVQRKVARK
GCKLIFCRMEKEVFSALSAAKLINSPSKELRDVIAGTVEQPRAMSIPNAIPEDEEFVDQE
DVHDIGLGHRKTQILMLRKDVTFEPLEPFGQGNDDAFDHETDALDFCAEKVVKEVVYFQG
AKLDPQLLQFRAACETGTRITESTFESLNSLPKGLMAEIKPSCKVLKDKTSVYFIFKGAV
SMVDSIQLNKAREGSSLAFTLNVGVKGFHGRGGKRLRKRYPPGTVVGKMAFALNRTGRML
DDGVQSELVVSSRQAYGTTAELWELTAESWDSLSEEIQNALRDLLIVQQAEERQHTFLCG
E
Download sequence
Identical sequences R1E3A9
jgi|Emihu1|211646|gm1.4800251 XP_005767858.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]