SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1EAK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1EAK2
Domain Number 1 Region: 197-312
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.75e-17
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Domain Number 2 Region: 48-76
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000285
Family LIM domain 0.024
Further Details:      
 
Weak hits

Sequence:  R1EAK2
Domain Number - Region: 109-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000202
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1EAK2
Sequence length 333
Comment (tr|R1EAK2|R1EAK2_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD23740.1, ECO:0000313|EnsemblProtists:EOD23740} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_373872 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MSKFCSSCGEPARLCHCKGRPSLPNCTSGSGQAPVGPSPGRASDQRTGLPACKGCGKPVQ
CRTISAMGGAYHPECFKCAGCGGAFVDRAAGFVEHGGCAYHRGCFTAPARACHFCSQPLI
GQAMKAAGAEFHPQCLPRCGTCGVSLEAGWYHDPSTDVRYCAAHAPRAPARGGRRAGSGT
VSAAALRLPRPPAVEQLDMRHMLKWAETAAAQSDPTVHIIDWSRSFADGRAFLAILRTYF
PEAVDASVLASSACAGEGSRLRAPEVRSACAHAFRLADELAGVPQLLDEGDMARNYPLPD
EKSVITYVCTLWGGLARAAERTEGKAGGVSASA
Download sequence
Identical sequences R1EAK2
XP_005776169.1.92643 jgi|Emihu1|373872|fgenesh_newKGs_kg.2831__1__2693091:1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]