SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1EMQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1EMQ6
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-33
Family Calponin-homology domain, CH-domain 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1EMQ6
Sequence length 168
Comment (tr|R1EMQ6|R1EMQ6_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD22159.1, ECO:0000313|EnsemblProtists:EOD22159} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_65122 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MDRLEPGAVDWGRVEGTPKNKYETVANCNYAVKVAKELGLKLTGISGQDISEGKEKLMLA
VWWQLMRKDFMQFLDDLDMDQAFVLSWANAQVARSGADMQLSRFGDPAIKSGVFLLQLMR
AVAPKAIKEDLIRPGHSELDRQLNAKLAISTAHKMGARVFCGWQDILE
Download sequence
Identical sequences R1EMQ6
XP_005774588.1.92643 jgi|Emihu1|65122|e_gw1.31.36.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]