SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1EX28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1EX28
Domain Number 1 Region: 186-301
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.59e-17
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Domain Number 2 Region: 35-65
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000218
Family LIM domain 0.024
Further Details:      
 
Weak hits

Sequence:  R1EX28
Domain Number - Region: 98-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00019
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1EX28
Sequence length 322
Comment (tr|R1EX28|R1EX28_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD31160.1, ECO:0000313|EnsemblProtists:EOD31160} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_99383 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MSKFCSSCGEPARLCHCKGRPSLPNCTSGSASDQRTGLPACKGCGKPVQGRTISAMGGAY
HPECFKCAGCGGAFVDRAAGFVEHGGCAYHRGCFTAPARACHFCSQPLIGQAMKAAGAEF
HPQCLPRCGTCGVSLEAGWYHDPSTDVRYCAAHAPRAPARGGRRAGSGTVSAAALRLPRP
PAVEQLDMRHMLKWAETAAAQSDPTVHIIDWSRSFADGRAFLAILRTYFPEAVDASVLAS
SACAGEGSRLRAPEVRSACAHAFRLADELAGVPQLLDEGDMARNYPLPDEKSVITYVCTL
WGGLARAAERTEGKAGGVSASA
Download sequence
Identical sequences R1EX28
XP_005783589.1.92643 jgi|Emihu1|99383|fgeneshEH_pg.18__181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]