SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1F1Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1F1Y2
Domain Number 1 Region: 449-560
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-26
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 34-132
Classification Level Classification E-value
Superfamily PH domain-like 0.0000201
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R1F1Y2
Sequence length 1138
Comment (tr|R1F1Y2|R1F1Y2_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD29216.1, ECO:0000313|EnsemblProtists:EOD29216} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_421172 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MVVENAPKANVKARMQALQGAGDVKDQPPAGEEVVTGWLKKAGTGVLASREYNRYCVLYA
GKPMHGFAPTLLYFEDEARSKPKGQTLLADGTAVEQSGLTVRLSQAGNKVLVKLTATTTG
DADHWRSSLNGVLGLETDTTPSRVEKVATPPPAKLPAAVPPPAKPQAKPARADRLSVEKA
METARLEAERRISQASEAAEAEASELLASGRTSQAETLRLSEAEVPVPALPKPPTAAAAA
AAAPAADLAIVPETPRGVPSNWDLPITAPKQVIFSAELGASPESQRDSPAKPTAPLQSKS
SLGMLESLTDDEEEEAAAALKPPPPRLSLVSAPRAPTPTTPPATNPGKTVVEIRLDHGRR
LSIDMSSAPPPGAPPPPPPGVPPPLTARGGVPPRPPVPPPLEQPGQAAPDVEGQPSSTPS
LDALVGEHEPEPAAAVTVAATPRATAKPNRRSSSLDKDDLMQWCQTTTEHYPGVRVANFS
RSWADGLALCAILHEYFPTDIGQFEALDGSTAEGRAANFELAFGVAERRLDVERLFDVED
MTATYPTPDAKSVITYVAMLSNKIKSMDAAGAAEAADATEAASKSLASQKRQGSSFLGAI
ANFFAPKEEKQAAQAKAEAEAAEAAAKAAAAEAAEAAAKAAAAEAEAAAEKAAAAEAEAA
AEKAAAAEAEAAAEKAAAAEAEAAAEKAAAAEAEAAAEKAVEEKAAAEKAAAEKAAAEKA
AEEKAAAEKAAAEKAAAEKAAEEKAAAEAAAAAAAATAAKAAEAAAEAAAKAAEEETKAA
EAKAEAEAAAAAQREAAEKAAAEEERLAAEAAAAEAAAAEKAAAAAAEAQAAEVAAAEAA
EAAAAEAAAAAAAAAAAAAEQGSEEVKPLESATSSQSIGFDAGVQLALSQLPDELKERIQ
SSFERGESLRIVLEEQPAPEPQPSDSSRQGSWLGWLGWGKKSSTPPQPPKAACPEPEARA
VENAEAASVKSYPAEVQKLAAYARAQRADQTGKRQAGSGTMAADHGVTAEGSQDLASKAE
RLGRLAERSSSVELSAAAAEVAAVAEALACEVAASAAASGAAAADLAAKGKVDALLANRD
SLGLRRALLMEVNAAVGSGTAHGSSAAEVDALNAALADCIRILATHNERKAAAVAPAA
Download sequence
Identical sequences R1F1Y2
jgi|Emihu1|421172|estExtDG_fgenesh_newKGs_pm.C_200016 XP_005781645.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]