SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1F9N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1F9N1
Domain Number 1 Region: 48-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.59e-35
Family Calponin-homology domain, CH-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1F9N1
Sequence length 391
Comment (tr|R1F9N1|R1F9N1_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD32116.1, ECO:0000313|EnsemblProtists:EOD32116} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_434215 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MTDHHFMSTRVPTKPVSNAVHAGYDGAAKREDGIPLYGMDKELADKAAAKFDPKMEREAR
EWIEAVTGEALEGTLQEALKSGVVLCALVNALKPGVCKKPSTMKMAFQQMENIAKYLEAC
SALGVPKHDLFQTVSLYENQDMMAVITNIHSLGRVSGKVPGYGGPTLGAKLADKSVRHFD
EETLRKGRAEQTFLGKGSHGNASQAGTVDTSRNIGKMDKVRGIDGLGTDASVTAVGMGSH
GHASQAGTVDTSRNIGKVDHVKGIDGLGTDASVTAVGMGSHGHASQAGTFDTSKNISKVD
HVKGIDGLGGDGTTTAVGMGSHGHASQAGTFDTSKNIDRTTNIKGIDGLGTDGISQINLG
SHGHATQEGMGKMHGTREIVHQTVGGAAAAA
Download sequence
Identical sequences R1F9N1
XP_005784545.1.92643 jgi|Emihu1|434215|estExtDG_fgenesh_newKGs_kg.C_170104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]