SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4G9T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4G9T2
Domain Number 1 Region: 120-298
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0000392
Family At5g01750-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R4G9T2
Sequence length 308
Comment (tr|R4G9T2|R4G9T2_ANOCA) Phospholipid scramblase {ECO:0000256|RuleBase:RU363116} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=LOC100557844 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MDSKNAAPGYPGPPTQYGYPQYAPGPGQYPPGPGQYPPGPGQYPPGQGQGFAGQPPYQPM
GYQGAYGAPPVQGQPNGVMWMPAPPPPANCPPGLEYLSQIDQILIHQQIELLEILTGFET
CNKYEIKNSLGQRVYFAAEESDCCTRNCCGSSRPFTMKIMDNMGQEVIELLRPLKCSSCC
FPCCLQELEVQAPLGTVIGYIKQNWHPCLPRFAIQNEASENVLKIAGPCAPCTCFQDIDF
EVSTQDEKPIGRISKQWTGYIREMATTASNFEILFPFDLDVKMKALILGASILLDYMYFE
HKRRRSDR
Download sequence
Identical sequences R4G9T2
ENSACAP00000021999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]