SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4G9Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4G9Y1
Domain Number 1 Region: 251-351
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-28
Family Ras-binding domain, RBD 0.0000025
Further Details:      
 
Domain Number 2 Region: 386-491
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.11e-24
Family FHA domain 0.00000137
Further Details:      
 
Domain Number 3 Region: 44-145
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 4 Region: 993-1090
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-22
Family PDZ domain 0.0000312
Further Details:      
 
Weak hits

Sequence:  R4G9Y1
Domain Number - Region: 1366-1498
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0173
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4G9Y1
Sequence length 1686
Comment (tr|R4G9Y1|R4G9Y1_ANOCA) Afadin, adherens junction formation factor {ECO:0000313|Ensembl:ENSACAP00000022051} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=AFDN OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MSGGGGGGGSREEERRKLADIINHWNANRLDLFEISPPTEDLEFHGVMRFYFQDRAAGNF
ATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDIDEKPLVVQ
LNWNKDDREGRFVLKNENDALPPKTQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRREKE
ALRQALDNDGPFHGDDIENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQE
FRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVIEALEKYGLEKENPKDYC
IARVMLPPGAQHSDDKGAKESILDDDECPLQIFREWPSDKGILVFQLKRRPPDYVPKKLK
KQVDGKPLKGKERVDGSSYGSSLPPEKLPYLVELSPDGSDSRDKPKLYRLQLSVTEVGTE
KLDENSIQLFGPGIQPHHCDLTNMDGVVTVTPRNIDAETYVEGQRISETTMLQSGMKVQF
GTSHVFKFVDPVQDHIPKGRLDAGHMVKSSRIKAGAVQETTFDLEGDIHSGTGLSTSKST
NRLDSDRMSTSSTAERGMVKPMIRIEQQQDYRRQDGRPQDLHGPELILPASIEFRETSED
AFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSSQYRPDISPAERTHKVIAIVNKMVSM
MEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMA
FKYLVHCLQSELNNYMPAFLDDPEENSPQRPKIDDVLHTLTGAMSLLRRCRVNAALTIQL
FSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRI
VQATTLLTMDKYLPEDIPNINSTCFKLNSLQLHALLQNYHCAPDEPFIPTELIENVVAVA
ENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLCQRGFCR
LTPHPRSPGTWTIYFEGADYENHLLQDNADLAQPLRKEPEIITVTLKKQNGMGLSIVAAK
GAGQDKLGIYVKSVVKGGAADADGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVT
LEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKPRPKSEGFELYNNSAQNGSPESPQP
WPEYNEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGTKNAYAAGTTNKITSVSTGNLCT
EEQILPPRPEAYPIPTQTYTREYFTFPASKSQDRMGPAQNQWSSYEEKAQVPEESNHYIS
AAMQRVTRSQEELRDDKVYHPERNRLEVVIRKDVEYIDRKSDSDPWMNSSVDSSTSSQEH
LNHSSKSIPPGSSLTKSGPGRWKTPIVPQPLSLAPAQSNRTDLPPPPPPPPVHYAAEFDG
LQMDLPLPPPPPPSSQLGPQASSQAAAAERKKREEHQRWYEKEKARLEEERDRKRREQER
KLGQMRAQPLIPTQPLLPPASVQQVKPEKPSTLQRSQETVIRELQPQQQPRTIERRDLQY
ITISKEELSSSDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQNKPDRTAEENDRL
RKLMLEWQFQKRLQESKQKDEDEDDEEDDDIDTMLIMQRLEAERRARDEERRRQQQLEEM
RKREAEDRARQEEERRRQEEERTKREAEQKRRQEEEYYNRLEAERRRQHDEAERRLLEPD
EPGPLP
Download sequence
Identical sequences R4G9Y1
ENSACAP00000022051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]