SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4Y5A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4Y5A1
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily ITPase-like 3.84e-56
Family YjjX-like 0.000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4Y5A1
Sequence length 173
Comment (tr|R4Y5A1|R4Y5A1_KLEPR) Nucleoside-triphosphate phosphatase {ECO:0000256|HAMAP-Rule:MF_00648} KW=Complete proteome OX=861365 OS=Klebsiella pneumoniae subsp. rhinoscleromatis SB3432. GN=KPR_0927 OC=Enterobacteriaceae; Klebsiella.
Sequence
MIMHHVVSATTNPAKIQAILQAFDEIFGEGSCHIESVAVESGVPEQPFGSEETRAGARNR
VANARLAQPNADFWVAIEAGIDDDSTFSWVVIESASQRGEARSATLPLPDVILEQVRAGE
ALGPVMSQYTGIDQIGRKEGAIGVFTGGRLTRSSVYHQAVVLALSPFHNAIYR
Download sequence
Identical sequences A0A060VIS2 A0A0E1CJP0 R4Y5A1 W8VI42
gi|238892980|ref|YP_002917714.1| gi|529986522|ref|YP_007989908.1| 484021.KP1_0811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]