SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5DVZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5DVZ3
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.67e-25
Family Ribosomal protein L9 C-domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily L9 N-domain-like 8.89e-17
Family Ribosomal protein L9 N-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5DVZ3
Sequence length 148
Comment (tr|R5DVZ3|R5DVZ3_9FIRM) 50S ribosomal protein L9 {ECO:0000256|HAMAP-Rule:MF_00503} KW=Complete proteome; Reference proteome OX=1262950 OS=Ruminococcus sp. CAG:108. GN=BN462_00866 OC=Ruminococcus; environmental samples.
Sequence
MKVILMQDVKSLGKKGELVEASDGYARNFLLPRKLAKEANAQAMNEYKNAENSKNYKIAT
QKAQAEHDKKTLEGKTFKMTAKAGQGGRLFGSVTSKQVAEEIKKQYNIDVDKRKVVLDCD
IKEFGTYHAEVKLFTGVSAKIDVQVSEA
Download sequence
Identical sequences A0A1C6C5N1 A0A1Q6RYW1 D4L7J3 R5DVZ3
gi|479151189|ref|YP_007781365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]