SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5LGX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5LGX0
Domain Number - Region: 7-63
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0228
Family Capz alpha-1 subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5LGX0
Sequence length 162
Comment (tr|R5LGX0|R5LGX0_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CCY72262.1} KW=Complete proteome OX=1262878 OS=Eubacterium sp. CAG:115. GN=BN470_00668 OC=Eubacterium; environmental samples.
Sequence
MNTTSNTFQHYLKVLFRPAQDWAFSEEGAAWIRENIPTLKALIQNHYKDKLFAVYCLKLN
GKHLYIGESIRTVQRLVVHAYNICHFPELFGLGDTLGNNSISVALLETGIYLNKARKDTE
AHYILALKPLIQKADGTDMCISIDKRHKAVMPYLKNHSGTFD
Download sequence
Identical sequences R5LGX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]