SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5NQG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5NQG8
Domain Number 1 Region: 8-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-84
Family Protein kinases, catalytic subunit 0.00000111
Further Details:      
 
Domain Number 2 Region: 423-484
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000536
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 
Domain Number 3 Region: 489-551
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000863
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  R5NQG8
Domain Number - Region: 354-416
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0955
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5NQG8
Sequence length 656
Comment (tr|R5NQG8|R5NQG8_9CLOT) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:CCY99621.1} KW=Complete proteome; Reference proteome OX=1262840 OS=Clostridium sp. CAG:793. GN=BN786_00576 OC=Clostridium; environmental samples.
Sequence
MNLIGKIIGNRYEILEEVGNGGMATVYKAKDHVLNRYVAVKVLKDEYTTDSDFIKRFNTE
AQSAASLSHANIVSIYDVGHEEENNLYYIVMELVKGKTLKEIIKKDGTLSWKWAVNIAIQ
IASALEVAHKNGIIHRDIKPHNIIITEDGVAKVTDFGIAKAVSNSTMTAFGTTIGSVHYF
SPEQAKGGITDAKSDLYSLGVVMYEMLTGKVPFDADTPVSIALKHMQEEAIEPIEINPEI
PTAVNQIVIKAMKKDPIERYQSATEMIRDLTQSLKDPDGDFVIIENKDGEYTRVMKAMPS
DETDSRKSNNKDSNFFAEHPKAKIAIFALSLVLLFVIVFFVTKIALDGGITKKVNIPNLV
DKTAEVAENEINSLKLKIEKEEVASSTVEAGKVISQEPPYKEGEKVEEGSTIKVVVSKGP
ETIALPGFVGSTIEDVRETAKEIGIVLKEENQSSDTVETGYVIRQDTKEGVMVKSGDTVT
VYVSTGVKKTKVPTVIDMDEGTAKATLSNANLKVNVTYKSDETKTDGKVISQSIDQGKEV
AEGTTIEIVVNKIEKKQKTVNVRFIIPKISTSATSKDNTTTETSNNATITVKINGSTRVN
GKTVEIGKEVDCGTVTGSGTQKIAVEITENGVKKAITNEFNIDDYEDNGTYYIKDK
Download sequence
Identical sequences R5NQG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]