SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5P9N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5P9N9
Domain Number - Region: 190-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0785
Family Capz alpha-1 subunit 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5P9N9
Sequence length 282
Comment (tr|R5P9N9|R5P9N9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CCZ13210.1} KW=Complete proteome; Reference proteome OX=1262919 OS=Prevotella sp. CAG:1092. GN=BN465_02391 OC=Prevotella; environmental samples.
Sequence
MEDRTFKKVDNSSFKERFQFTFSINENVICQRYFRINGFNYSSIETLELKEVMDECVAMI
QKDLVEKSRVYMWYTNNDPIKMTGFVKTDNLTSDDVAVLTNGVEGCTTLSDGQTINKTYF
DYYNATPSSQDYVDERPDEGEFVFKFAFLIDDKKVYEKVWDGNIYPKYVRNSVDLSNSDA
LYRGKEPSSLSFALAIVYHMTNGKQDLLYHMIKKICDTLSNSYSENYEYTKKEKYGDKTY
HFTTYNRDYVDGWRKAVNRKTNDYFNHMYPTQGQIDFINKYL
Download sequence
Identical sequences R5P9N9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]