SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5TP24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5TP24
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-83
Family Protein kinases, catalytic subunit 0.00000168
Further Details:      
 
Domain Number 2 Region: 477-538
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 
Domain Number 3 Region: 404-465
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0081
Further Details:      
 
Weak hits

Sequence:  R5TP24
Domain Number - Region: 544-603
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5TP24
Sequence length 693
Comment (tr|R5TP24|R5TP24_9FIRM) Serine/threonine protein kinase {ECO:0000313|EMBL:CCZ65094.1} KW=Complete proteome; Reference proteome OX=1262949 OS=Roseburia sp. CAG:50. GN=BN683_02122 OC=Roseburia; environmental samples.
Sequence
MLKNGTYIADRYEVVGQIGTGGMSDVYKAKDHTLGRYVAIKVLKEEFSEDTNFVTKFRSE
AQAAAGLEHPNIVNIYDVGSENGIHYIVMEYVEGITLKTYIEKKGQLNYKETLSIAIQVS
RGIQAAHAKHIIHRDIKPQNIIISTDGKVKVTDFGIARAVSEHTIHSDVMGSVHYASPEQ
ARNGYVSNRSDIYSLGIVMYEMVTGRVPFDGDSTVAVAIQHLQDEMVPPSTYAPNLPISL
EKIIQKCTQKSPDRRYDSMESLLIDLRKALLNPNEDFVTLVPFNQDKTKTRVLTDDEVSQ
IRKQAETVNLEPEKKTMAQEVPEEDDEDYDMSEYDEDDDEEEGRFLNSKMEKIVGIMRIV
VAVIIAIIVIYLIGSFFDIFHFGPGNKNNKKDDTQITQEEKETVVMIDLKGKTLSEAEKD
LKELGLKVTEAGTEVSDTYEKGEIIAQDVSEGETVKAGTTIKVTVSAGSEEENAKEVDVP
DVTGKTSDAAMATLEDKNLTVSREFEFSNDVPAGQVIRQDPKSGSTVKEGTKVTIYVSQG
SESVKVPDVRGKSEADAKAALSEFAVTTTTEHSDSVASGNVISQSIDAGQYADKGAAITI
VISSGPEKVTYYINSKVSAPTDVTVTSADIELYKSESNDLIQNWNGVTSFPYTLEAHGID
VPKGTIVITWHYTDANGNAATSTQKKEISFNKE
Download sequence
Identical sequences R5TP24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]