SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5UYG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5UYG1
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Urease metallochaperone UreE, N-terminal domain 0.000000222
Family Urease metallochaperone UreE, N-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  R5UYG1
Domain Number - Region: 104-130
Classification Level Classification E-value
Superfamily Urease metallochaperone UreE, C-terminal domain 0.00405
Family Urease metallochaperone UreE, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R5UYG1
Sequence length 191
Comment (tr|R5UYG1|R5UYG1_9BACT) Urease accessory protein UreE {ECO:0000313|EMBL:CCZ76166.1} KW=Complete proteome; Reference proteome OX=1263035 OS=Alistipes finegoldii CAG:68. GN=BN754_01743 OC=Alistipes; environmental samples.
Sequence
MKIYTEIIGNLQDPEWVKKAREAEIEYIDLDQWTAQKSRFVVKGDRENEYAVALKRHSQM
LDGDIIEYLPEQRRIAAIRIRLNDVLVADLSDLARQTPETIIHISVELGHAIGNQHWPAV
VKGTKVYIPLTVDKKVMDSVMRTHHIEGVAYSFQPGSEVIPYLAPHEIRRLFGGTGPDSD
VHHHHEHVHAH
Download sequence
Identical sequences E4MA00 I3YK97 R5UYG1
WP_009597096.1.56960 WP_009597096.1.9852 gi|390946340|ref|YP_006410100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]