SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5Y149 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5Y149
Domain Number 1 Region: 9-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-80
Family Protein kinases, catalytic subunit 0.00000168
Further Details:      
 
Domain Number 2 Region: 476-536
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0051
Further Details:      
 
Domain Number 3 Region: 405-468
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0054
Further Details:      
 
Weak hits

Sequence:  R5Y149
Domain Number - Region: 543-601
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 611-671
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0719
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5Y149
Sequence length 696
Comment (tr|R5Y149|R5Y149_9FIRM) Non-specific serine/threonine protein kinase {ECO:0000313|EMBL:CDA14931.1} KW=Complete proteome; Reference proteome OX=1263009 OS=Firmicutes bacterium CAG:212. GN=BN537_00257 OC=Bacteria; Firmicutes; environmental samples.
Sequence
MLKEGVFLGKRYEILGRIGSGGMADVYKGKDHKLNRYVAVKVLKSDYRNDESFIKKFVSE
AQAAAGLMHPNVVNVYDVGQDRGLYYMVMELVEGITLKEYIEKKERLSAKEAISISIQMI
SGIQAAHNHHIIHRDIKPQNIIISKDGKVKVTDFGIARATTSTATISTNVMGSVHYTSPE
QAKGGIVDERSDIYSAGITMYEMVTGHVPFDGDSTVSVALKHLKEKIVAPSVEVPDIPYS
LDCIIMKCTEKNVERRYQNCQDLISDLKHSLVDPDGHFVDEQLDVFTGRKPAGDETILMS
EDEIRRAQERSYSQSDDYDDSDYDDDDYDDDDYDDDDDDYRAPTQRRNSDYNRKKNVDPN
TKKIMKILMVVAAAIIAMVIIFMVGNAMGAFKGGIGLNTTTNDAKVVVPNLLGMTEDEAK
AALKKKNLGYSIAGREESDKYAAGEIMEQSEKANSKVEKNTEIKVVISTGKAKKTVSVPD
VKGMSEDDAQKTLENLNLVVEAQAQNDDTVASGKVISTDPAAGTQLTEGSKVTMYVSLGI
ESVEVPSITGMSSEEAQSAIQNVGLQASVTEDYSDTVASGMVISQDPASGKVKKGSTVNI
VVSKGAKVKMVTVPSLSGMTQQAAEQAIIDAGLTVGSVTEEYNAGVSAGYVISQTASVGS
QIEKGSSVGFVVSKGAQPSTDNGNTGGEDNESSELQ
Download sequence
Identical sequences R5Y149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]