SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5YSD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5YSD4
Domain Number 1 Region: 8-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-85
Family Protein kinases, catalytic subunit 0.00000103
Further Details:      
 
Domain Number 2 Region: 430-490
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 
Domain Number 3 Region: 499-560
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000942
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 
Weak hits

Sequence:  R5YSD4
Domain Number - Region: 361-423
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0172
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R5YSD4
Sequence length 668
Comment (tr|R5YSD4|R5YSD4_9CLOT) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:CDA30338.1} KW=Complete proteome; Reference proteome OX=1262813 OS=Clostridium sp. CAG:492. GN=BN681_00639 OC=Clostridium; environmental samples.
Sequence
MNLEGSVIGNRYKIQEKIGNGGMATVYKALDQILNRYVAVKVLREEFTTDEEFIKRFNAE
AQSAARLTHPNIVSVYDVGQEYNIYYIVMELIQGKTLKQIIEEDGHLSWKWAVNIAIQIA
SALEMAHKNNIIHRDIKPHNIMITEDGVAKVTDFGIAKAVSNSTITAFGTTLGSVHYFSP
EHARGGYTDSKSDLYSLGVVMYEMVTGKVPFDADTPVSIALKHMQEEPVPPMKVNKEIPF
AVNQIILKAMKKDPNERYQNASEMIKDLNIALKRPEGGFVEERNFEDSFTRRIPTVNVSD
NRNGNIKSDNEEEKPKGKIATFFYNHPKTKVASIIALFVLIFVATLVITLTVINSSSPKD
VQIPNVVNLTQEEAKQRIEQLKLKFAYKEEYSADVEAGHVISQDPQYINNYSVKEGSTVT
VVISKGMEQTKVPKVIGMEYSKAESALTEAGLEVEKVEETSQKVEAGYVISQEIDANTEV
QKGTKIKIHVSTGTGIKKVTVTSVIGKSSEEAKKILTDLKLEVNVVEDEDTSKSDGVVLK
QSVDPGTSVEEGSAITITVNKIEKNKQGTVNINVKALANRHLPKSSGEEEDNTTTTSNNV
KITVMVGSDKVYSQKVSRDTEKLNVTVEGKGNITVKVYIANEDESSNGILAKNATIDLNS
ENTVLNVD
Download sequence
Identical sequences R5YSD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]