SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5ZIR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5ZIR9
Domain Number 1 Region: 6-85
Classification Level Classification E-value
Superfamily YhbC-like, N-terminal domain 1.96e-25
Family YhbC-like, N-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 87-154
Classification Level Classification E-value
Superfamily YhbC-like, C-terminal domain 0.00000000000000144
Family YhbC-like, C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5ZIR9
Sequence length 156
Comment (tr|R5ZIR9|R5ZIR9_9FIRM) Ribosome maturation factor RimP {ECO:0000256|HAMAP-Rule:MF_01077, ECO:0000256|SAAS:SAAS00820398} KW=Complete proteome OX=1263077 OS=Eubacterium eligens CAG:72. GN=BN765_00087 OC=Eubacterium; environmental samples.
Sequence
MGKRESYEAKTTELIQPVVEANGVELFDVDYVKEGSDWYLRVYIDKEGGVTIDDCQNVSR
AFNEILDRENYIDDQYIFEVSSPGLTRPLKKEKDYEKSIGRMIEIKLFSPVDKSKEYSGV
LKEYDKDTVTISIDDVTKTFDRSNLAMIRWAFVDEV
Download sequence
Identical sequences A0A174YQV9 C4Z5N3 R5ZIR9
gi|238916822|ref|YP_002930339.1| WP_012739128.1.40640 WP_012739128.1.74791 WP_012739128.1.89035 515620.EUBELI_00890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]