SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5ZKR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5ZKR4
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.000000484
Family Cell division protein ZapA-like 0.0067
Further Details:      
 
Weak hits

Sequence:  R5ZKR4
Domain Number - Region: 79-133
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5ZKR4
Sequence length 135
Comment (tr|R5ZKR4|R5ZKR4_9FIRM) Cell division protein ZapA {ECO:0000256|SAAS:SAAS00072473} KW=Complete proteome OX=1263077 OS=Eubacterium eligens CAG:72. GN=BN765_01588 OC=Eubacterium; environmental samples.
Sequence
MSSKNTAEVILGGKVIKLGGYESEEYLQRVASYINNKITEFNKEESYRRMSAELRTDMMY
LNIADDYFKAKKMADSLSLDIENKDKEIYDLKHELIAAQIKAESSAKEIKELKSEINKYQ
KNIVKLETELNDSKK
Download sequence
Identical sequences A0A174Z651 C4Z032 R5ZKR4
APC21094 WP_012739181.1.40640 WP_012739181.1.74791 gi|238916875|ref|YP_002930392.1| 515620.EUBELI_00944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]