SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R6H3P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6H3P8
Domain Number 1 Region: 8-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-82
Family Protein kinases, catalytic subunit 0.00000157
Further Details:      
 
Domain Number 2 Region: 542-603
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.008
Further Details:      
 
Domain Number 3 Region: 474-533
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000824
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Further Details:      
 
Weak hits

Sequence:  R6H3P8
Domain Number - Region: 405-463
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000733
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R6H3P8
Sequence length 714
Comment (tr|R6H3P8|R6H3P8_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CDB20917.1} KW=Complete proteome; Reference proteome OX=1262758 OS=Blautia sp. CAG:52. GN=BN690_00273 OC=Blautia; environmental samples.
Sequence
MLKEGMIVGERYEIISRIGSGGMADVYKAKDHKLNRLVAVKVMKAEFSQDKGFISKFRKE
AQAAAGLAHPNVVNVYDVGEDNGIYYIVMELVQGITLKDYITRKGKLSVREATSIAIQVS
LGLEAAHKSNIVHRDVKPQNIIISVDGKVKLSDFGIARAASSNTISSNVMGSVHYSSPEQ
VRGGYSDAKSDIYSLGITMYEMVTGHVPFDGDTTVAIAIKHLQEEIVSPRKYVPDLPYSL
EQIILKCTQKSVDRRYENMSEVIEDLKHSLLDPNGNFVVVTPLAQHAQTVMLSNDELEAI
REGRSGYATPQKDTYEEEEDDDEEEYDDEYDDDEEDDEDGEVSSKLEKAMTIGGFIIGAI
IICILIFFIARAAGLVNIGGTAKKDDTQQTEQEEIDDTVDENGQVSVPKLTSMTEENALS
VLEQLGLKGNKTGESQSSEYKAGTIMSQETEAGTKVDQGTVINYVVSSGTDAPSVPSVTG
KSQSEAEALIKALGLNTEIQQDYSDTVAIGKVISVNPSEGTKVDAGSTITLVVSLGEENK
QVEVPNVIGQDEATAKKSLNDQGLQVNVETTTDASGNVAEGCVANQSVAAGTSVDPGSTI
TLQVYHAPETTTLPNEAPAEEDASDSDTGSWTCNVKLDQPSTYTGGPVQLTLVQNVNGQN
VETVILDGQTITFPYTLAIAGADGVDTGTVYLREMVDGDYVERGHYSNVPFKQS
Download sequence
Identical sequences R6H3P8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]