SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R6HMJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6HMJ6
Domain Number 1 Region: 5-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-82
Family Protein kinases, catalytic subunit 0.00000139
Further Details:      
 
Domain Number 2 Region: 435-496
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000011
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0079
Further Details:      
 
Domain Number 3 Region: 368-429
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000719
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0095
Further Details:      
 
Weak hits

Sequence:  R6HMJ6
Domain Number - Region: 501-563
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R6HMJ6
Sequence length 638
Comment (tr|R6HMJ6|R6HMJ6_9FIRM) Kinase domain protein {ECO:0000313|EMBL:CDB35409.1} KW=Complete proteome; Reference proteome OX=1262915 OS=Phascolarctobacterium sp. CAG:266. GN=BN574_01509 OC=Acidaminococcaceae; Phascolarctobacterium.
Sequence
MNNGTILKQRYKILRHIGSGGMAEVYLAEDLLLNRQVAIKILRDQFNDDKTLLNQFKHEA
QSAARLSSPSIINIFDVCEEEGKSFIVMEYVEGKTLKDLLEEKGRLSPYKAVCIAEDIAA
GLSHAHRRNIIHCDIKPHNILITENMHPKIADFGIARMISNMTMVYTNSVIGSVHYLSPE
QASGKPVTAQSDIYSLGIVLYEMLTGHVPFDGNTAVAVAMMHVEKTPPPLSTYVDGLPVC
LQHVIDKALAKDLTKRYASAEEMRQDLNFIKNKMEKNGEAEDYTEADSFIDEVNEKSALV
TDETEVPEETIVMTVPAAPAKPKAKKSWLQKMKETQLTRHQQIMLAAVVVVLSAVFLLIG
NVFSRETVKVPDVTGKTVVEAQQILENAGFSITLKEAYDDKVTPGLVLEQDPAGNEMRKE
GSAVYLTVSKGIEMVEVPNLAGKNLADARKMIERKKLALGKVETVFREDGSGLVIEQTPK
ANEKIRHGEKVNLVISEKPKEVTIPSVVGKASGEAMTALEKLGFKNITAQSVGSKKVAGT
VLSITPKEGSKVLNSTDVVLRVSDGVGTASQNKYAEFVVPDGAKKQKVKIVVVDDDGEKV
VYEGTKREGVRIRQKVEVSGSAVARFYCDNKLIEEKQL
Download sequence
Identical sequences R6HMJ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]