SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6LFH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6LFH4
Domain Number 1 Region: 120-271
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.31e-51
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0000703
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 9.64e-36
Family DHN aldolase/epimerase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6LFH4
Sequence length 272
Comment (tr|R6LFH4|R6LFH4_9FIRM) 7,8-dihydroneopterin aldolase {ECO:0000256|RuleBase:RU362079} KW=Complete proteome OX=1262862 OS=Coprococcus sp. CAG:131. GN=BN485_00630 OC=Coprococcus; environmental samples.
Sequence
MDSINIKGLEVFAHHGVYREENVLGQKFVVDVSMQVSTQEAGRSDDIRKSVNYGSVCDGI
QKVMKNRNYKLIETVAEEIADMILLTYDDVRGVNVTVKKPWAPVMVHVDTVSVSISRKKH
TAYLGLGSNIGDRESYLDMAIDELNKDKYTKVTRVSDFIETEPYGGVEQDDFLNGCLEIE
TLRTPEELLRLVNGIEKAAGRERLIHWGPRTLDIDILLYDDVVYDSEDLHIPHVEMHKRE
FVLEPLSMIAGYKRHPLLGKTISELRAGLDKQ
Download sequence
Identical sequences R6LFH4
WP_022216256.1.35782 WP_022216256.1.80485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]