SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6RAJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6RAJ5
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily YheA/YmcA-like 2.88e-21
Family YheA-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6RAJ5
Sequence length 137
Comment (tr|R6RAJ5|R6RAJ5_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CDC44895.1} KW=Complete proteome OX=1263080 OS=Eubacterium siraeum CAG:80. GN=BN788_01582 OC=Eubacterium; environmental samples.
Sequence
MDAIKAARELGKAIQADERYVRYNEAMKANDADMELQELIGEFNLARQNVALEMSKSKEE
QNKEKLDTQNKEMQRLYTLVMQNEHMADFTMAKADMDKLLHEINGIIALCCDGEDPDTCE
VQAGGCSGSCSTCGGCH
Download sequence
Identical sequences A0A175A6V1 A0A1Q6NV11 B0MNS8 D4JRX3 D4MKA6 K1RE64 R6RAJ5
gi|479143881|ref|YP_007774744.1| gi|479211936|ref|YP_007839718.1| WP_005352016.1.40803 WP_005352016.1.81606 WP_005352016.1.86524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]