SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R6XTU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6XTU9
Domain Number 1 Region: 9-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-83
Family Protein kinases, catalytic subunit 0.0000015
Further Details:      
 
Domain Number 2 Region: 428-487
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0084
Further Details:      
 
Domain Number 3 Region: 495-557
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Further Details:      
 
Weak hits

Sequence:  R6XTU9
Domain Number - Region: 358-421
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00163
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6XTU9
Sequence length 652
Comment (tr|R6XTU9|R6XTU9_9CLOT) Serine/threonine protein kinase {ECO:0000313|EMBL:CDD27148.1} KW=Complete proteome; Reference proteome OX=1262810 OS=Clostridium sp. CAG:452. GN=BN664_00657 OC=Clostridium; environmental samples.
Sequence
MNLEGKLLGNRYEIIEKIGSGGMATVYKAKCLVLKRFVAVKVLRDEFTTDEEFIKRFNVE
AQAVASLTHPNIVSVYDVGHEGNLYYIVMELVKGKTLKEIIVEDGALGWKWSVKIAMQIA
SALETAHRNNIIHRDIKPHNIIITEDGVAKVTDFGIAKAVSNSTITAFGTTIGSVHYFSP
EHARGGFTDARSDLYSLGVVMYEMVTGRVPFDSDTPVSVALKHMQEEPIEPIKIKPDLPQ
CVNDIIMKAMRKDANERYQTATEMIKDLELALKHPEEKFVSAPNIGDFPTQKISLDYAEE
LQKQEKGKKPGKFDKIKKYFEEHPAVKVIAIIVACILVFSIAMGGTYLALSLGRAKEVQI
PNLQGLTKEEAEQKAKESKLKIEVSEEKYHLEVPEGQIIEQDPKYQDNYKIKEGTTIKVV
ISKGQEIVEMPKVVGKTRDEATKMLKEVGLEVKVEEEFSDDVEKNYITKQEVAEGEKIAA
GTTVTIYSSMGIEQVQVPDLSGKTESEAKSAISSAKLKWKSTDKTSDSSKPNGVVVNQSI
SSESMVDKNTEITITVNEFDEIKTGTINVNVKSLLGGKVEYEDEEKTVVKNVRVKIMVGS
DTVYDEKVSPTSTNIKATKSDKGSKEVTVYIDDIWKATKTFNFNTQSSITIE
Download sequence
Identical sequences R6XTU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]