SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R6YHQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6YHQ7
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-83
Family Protein kinases, catalytic subunit 0.00000145
Further Details:      
 
Domain Number 2 Region: 423-482
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000641
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 
Domain Number 3 Region: 496-552
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 
Weak hits

Sequence:  R6YHQ7
Domain Number - Region: 353-415
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00471
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6YHQ7
Sequence length 651
Comment (tr|R6YHQ7|R6YHQ7_9CLOT) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:CDD17962.1} KW=Complete proteome; Reference proteome OX=1262841 OS=Clostridium sp. CAG:798. GN=BN787_00109 OC=Clostridium; environmental samples.
Sequence
MSLEGKIIGNRYEVLEKIGIGGMATVYKAKDNILKRNVAVKVLRDEFTTDEEFIKRFNTE
AQAAASLTHPNIVSIYDVGHEDNLYFIVMELIQGKTLKQIITEDGVLPWKWSINIAIQIA
SALEIAHKNNIVHRDIKPHNIIITEDGVAKVTDFGIAKAVSNSTITAFGTTIGSVHYFSP
EHARGGYTDAKSDIYSLGVVMYEMMTGRVPFDADTPVSIALKHMQEKPVEPIKLNPSIPY
AVNKIIMKAMQKEVALRYSSATEMLKDLNAALKNPDGNTVMPDQNIENSYTQRIPTIQGG
EKMNQKERKVNAFFKKHKKAIMIAIIVLIVILIPVIGFYGTQAILNVGRAKDVKLPNLVG
KTIEEAEQELNKSKLKIEKKEEFNSEIEAGKIISQNPPFIENYTVKENSTVEVVVSKGTE
MTKVPKIIGMEYEEAEEEIKKYNLQAEKIDKVSKTVEKGIVIEQEPAENTEIKAGEKVKI
YVSCGNGLKQIVTQYVIGKTEKDAKELLTKDGLEVEVVNEEDTTKENGIVLKQSIEAGKT
VDEGTKIIITVNKIAEIKTGKIDINLKSITGGIKLDAEGNEINPEATVTVKVTSAGKEET
VYNEKHRKDTSTIIFDVKGVGTITIKVYVDDVLKRQTQMNLNSSDTFWRAE
Download sequence
Identical sequences R6YHQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]