SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7F818 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7F818
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-82
Family Protein kinases, catalytic subunit 0.00000136
Further Details:      
 
Domain Number 2 Region: 430-490
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000103
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0054
Further Details:      
 
Domain Number 3 Region: 499-560
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000113
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 
Weak hits

Sequence:  R7F818
Domain Number - Region: 360-422
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00563
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7F818
Sequence length 661
Comment (tr|R7F818|R7F818_9CLOT) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:CDE10761.1} KW=Complete proteome; Reference proteome OX=1262799 OS=Clostridium sp. CAG:354. GN=BN623_00435 OC=Clostridium; environmental samples.
Sequence
MDLEGKILGNRYEIIEKIGNGGMATVYKSKDRVLNRYVAVKILRDEFTTDEEFIKRFRIE
AQSAASLTHPNIVSIFDVGNEGSLYYIVMELIKGKTLKEIITEENGPLPWKWSLNVVTQI
ASALETAHKNNIVHRDIKPHNIIITEDGIAKVTDFGIAKAVSNSTITAFGTTIGSVHYFS
PEHARGGYTDAKSDLYSLGVVMYEMLTGRVPFDADTPVSVALKHMQEEPVQPKELNDNIP
QVVNDIIMKAMQKDVNLRYQSATEMLKDLNAALRNPDDNFVHIGSNVGAATQRISTQEIA
EAERKAKEANNPKNGKKPNKFIEFVKKHKALSFVIGAIILFFVAFGTTMGIVELVNPKDV
QIPDLVNKTQNEAEQIVKDLKLKLVVKSEEYNENVEEGKIISQDPAYQENYTIKEHSEIS
VVVSKGTETVEVPDVVGKTREEAEKLLKDAGLVAEITEENDEKVEAGIVLSQDIEDGETV
NKGSTVNLVVSKGSGIVNVEVPSLVGKTEQEARNLLTEAGLKVNVVNDEDESKNDGVVLR
QSKDAGTEVQEGTTITITVNKVSESKEATFTIDVKAITGGYEEETGNTTSSNTAKTVDIT
ITVGGTTAFQQSGVDKNRTITAKVSGKGSKEVIVELKNSKGESYKRSTTFNFNNSTTYTF
D
Download sequence
Identical sequences R7F818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]