SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7IVI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7IVI8
Domain Number 1 Region: 9-271
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-83
Family Protein kinases, catalytic subunit 0.00000132
Further Details:      
 
Domain Number 2 Region: 494-555
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000719
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 427-487
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000327
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Weak hits

Sequence:  R7IVI8
Domain Number - Region: 356-418
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00759
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7IVI8
Sequence length 659
Comment (tr|R7IVI8|R7IVI8_9CLOT) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:CDE55674.1} KW=Complete proteome; Reference proteome OX=1262788 OS=Clostridium sp. CAG:269. GN=BN577_00799 OC=Clostridium; environmental samples.
Sequence
MNLEGKLLGNRYEIIEKIGNGGMATVYKATDKVLKRNVAVKILRDEFTTDDEFIKRFEVE
AQSAARLTHPNIVSIYDVGVDGNLYYIVMELIQGKTLKEIIVKEKGPLPWKWSINVSIQI
ASALEMAHRNNIIHRDIKPHNIIITEDGVAKVTDFGIAKAVSNSTITAFGTTIGSVHYFS
PEHARGGFTDAKSDLYSLGVVMYEMVTGRVPFDADTPVSVALKHMQEEPVEPIELNPNLP
IAVNKIIMRALQKDTTLRYQTASEMLVDLKKSLKDPEGDFVEELEYDPTARTQVIDTNAY
RDNKQTKNSSGKKDGKFKTFVKTHKGLSIFIGLLLLFVLSLGGTMLVLNLTNPPEVAMPN
VVGLSKEGAQKEIENVKLKFEIEKEEYNKDVPEGFIISQDPTYMEKFNKVKQGSTVKVVV
SKGEEKTTVPKVVGMEKDKAVKALEDAKLKVEIVEESSKKVQEGYVISQETSPDTEAFAG
DTIKIHVSTGVEKATVPDVIGKSQADAKKTLEAQGFVVAVTTSEDSSKENGIVLKQSLDS
GKTVEKGSTVTITVNSYEASKTMSVNINVKAITGGYSEETSNSNTTESKTVKTVSITLKS
GNNTLYSDSGVDKNTTSKSTTISGKGSMDLTLTITDSNGGSWTRTKSVNFSNDSSVNFN
Download sequence
Identical sequences R7IVI8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]