SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7LSE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7LSE6
Domain Number 1 Region: 4-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-84
Family Protein kinases, catalytic subunit 0.00000134
Further Details:      
 
Domain Number 2 Region: 492-553
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000406
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 425-485
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  R7LSE6
Domain Number - Region: 353-383
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00929
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7LSE6
Sequence length 657
Comment (tr|R7LSE6|R7LSE6_9CLOT) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:CDE91011.1} KW=Complete proteome OX=1262801 OS=Clostridium sp. CAG:389. GN=BN638_00700 OC=Clostridium; environmental samples.
Sequence
MNLEGKILGNRYEIIEKVGNGGMATVYKATDLVLKRYVAVKVLRDEFTTDEEFIKRFETE
AQSAARLVHANIVSIFDVGVDNGIYYIVMELIQGKTLKEIIVEERGPLPWKWSVNVAIQI
ASALEMAHKNNIIHRDIKPHNIIITEDGIAKVTDFGIAKAVSNSTITAFGTTIGSVHYFS
PEHARGGYTDAKSDIYSLGVVMYEMVTGKVPFDADTPVSVALKHMQEEPIPPIEANPHLP
EAVNKIILKALKKDPMLRYQTATELLQDLRMALKNPSGDFVNDEDYDPTARTQRISTQDV
DRMQKNSRKKEDNKFVAFIKNHKVFSSFIGLILLFFIAFGGTMLVLKATNPKEVEMPNIV
GLTKDEAQQKVESAKLKFVVSSEEYNTDVEENYIISQEPTYVEGYNRVKEGSEVKVVVSK
GTEKTKVPKVVGMSKDDAIEAIENAKLKAEIVEESSKKVQEGYVINQETDANTEVNAGET
VKIHVSTGTEKATVPGVVGKSQDEAKKMLQDLGFVVTVTTSEDNSKNNGVVLKQSLDEGK
SVDKGSAITITVNTYEASKSAQVTIDVKSYLPKTTTTTNNEATSNNTDRTANVKVTVSNN
GTGFSKNNVSSTVTDTIYGKGEVTITITITGTSGEQYYSGSKVINLNNTDSVTFKNN
Download sequence
Identical sequences R7LSE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]