SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7SGN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7SGN6
Domain Number 1 Region: 8-232
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 9.16e-21
Family DJ-1/PfpI 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7SGN6
Sequence length 234
Comment (tr|R7SGN6|R7SGN6_CONPW) DJ-1 PfpI family protein {ECO:0000313|EMBL:EIW74199.1} KW=Complete proteome; Reference proteome OX=741705 OS=Coniophora puteana (strain RWD-64-598) (Brown rot fungus). GN=CONPUDRAFT_170224 OC=Coniophoraceae; Coniophora.
Sequence
MSEQKHPRVLCLPYPHFDNLDLNGPLEVLAGAEWDIVVAAADEFTQVGHGYSLRRSITYA
EALATLDSFAALLIPGAAPDAILPYLKEGETHFDGLLDVAEAFTKLGPAEDGTERVMLTV
CTGSLVPAYRGLFDGLRATTHFMAYDLLTEVSEGYRKRNPGAAKGVTLVGPVEGKEPRGR
WVDAGRNAHGVRVISAGGVSCGIDATLFIVSERYGRDKALKIAEIMEYAWRENV
Download sequence
Identical sequences R7SGN6
XP_007775566.1.51617 jgi|Conpu1|170224|estExt_Genemark1.C_210040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]