SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7T2W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7T2W9
Domain Number 1 Region: 4-182
Classification Level Classification E-value
Superfamily ITPase-like 6.28e-61
Family ITPase (Ham1) 0.00000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7T2W9
Sequence length 186
Comment (tr|R7T2W9|R7T2W9_DICSQ) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_03148} KW=Complete proteome; Reference proteome OX=732165 OS=Dichomitus squalens (strain LYAD-421) (Western red white-rot fungus). GN=DICSQDRAFT_58419 OC=Agaricomycetes; Polyporales; Polyporaceae; Dichomitus.
Sequence
MITAFVTGNAGKLREVRQILGAANIEVDSQELDIPEIQGSTREVAIAKCRRAAELLGRPC
ITEDTALCFKALNGLPGPYIKYFLKELGHDGLNNLLVGFDTKEAWALCTFAYSAGPGHEP
ILFEGRTDGKIVPARGPSYFGWDPCFEPDGFGLTYAEMASEQKNKISHRGRALEKLEQYL
RTLPAQ
Download sequence
Identical sequences R7T2W9
jgi|Dicsq1|58419|e_gw1.10.192.1 XP_007364899.1.3125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]