SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7W5D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7W5D2
Domain Number 1 Region: 307-391
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 8-55,90-123,192-219
Classification Level Classification E-value
Superfamily POZ domain 9.94e-18
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7W5D2
Sequence length 505
Comment (tr|R7W5D2|R7W5D2_AEGTA) Regulatory protein NPR1 {ECO:0000313|EMBL:EMT02606.1, ECO:0000313|EnsemblPlants:EMT02606} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_21884 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MSSEDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPS
HQPPPPPLNWPNAGGGSGGGGGGGSRGGSGGAPATPELVIPVSSIRYEVLVLVLQFLYSG
QASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQIIIWENLS
MQKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVA
KIEEIRAKSPLAGGGASQPRSPFLTHHYLPINNGPSSAADRDHKIRRMRRALDAADIELV
KLMVMGEGLDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTPLHLAAEMVS
PDMVSVLLDHHADPNARTLDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQ
SAVMVTTRDDGGGGDGGGAGGSDGGNFGRGDADDSLVVHRLGFGSGVSGVFPQSDLFNGN
GFVFGEPLWKSAKLHIRDGVASSSR
Download sequence
Identical sequences R7W5D2
EMT02606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]