SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7WA27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7WA27
Domain Number 1 Region: 320-475
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-44
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7WA27
Sequence length 858
Comment (tr|R7WA27|R7WA27_AEGTA) Auxin response factor {ECO:0000256|RuleBase:RU004561} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_02482 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MSNPTTINCLYNMKTVARDFALQLWRVASPYPRNHVHLTVPSQPRSPRRTLEATFTSPLE
EDEVDIEGGSSFFADELATQANANKKRQSIQTKAYTKDEDKLLCECWRDIGQDPKIGAEQ
KAPTFWLSVHRQFHECKKFAPYKMESKRGWVSLSKRRRVIQQECNKFCATLESIEGRPMS
GFGIKDMAFQALEAFKAQHGNKPSTLTYCWMVIKGDEKFKEQYVALRKSGGLEAVEEHGV
GEKPRPRGKTNSKTDDERAASSNQQKANKMRVCLDRRVALKSKEKADPATDEVYARLALV
AEGEVFEKNMGGGRFEGEDDMEDGDGERKSRMLHMFCKTLTASDTSTHGGFSVPRRAAED
CFPPLDYQQIRPSQELVAKDLHGAKWRFRHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAV
LFLRGDDGELRLGVRRAIQLKNEALLKAFNSNSSKIHTLSAVANSLKHRSVFHICYNPRA
AASEFIIPYWKFLKSLNRPFCIGMRFKIQYGSEDVNERRSGMITGINDVDPIRWTGSKWK
SLLVRWEDGTDCNSQNRLSPWEIEIVGGSVSIAQSLSASSSKRTKLCPQGNVDVPTLYGN
GRPDSVGADKLPRVLQGQELMGSGTHRVTCPPQPGGATEFRRSDGTGFLANTRSCMLSGP
ASRFPPQSPYFAYQPVGFGESVGFPEVLQGQEVSQTVPLFQGIVSDTCSAKGGYGLYNYM
RPSSAMNGGFSSAAQGYPLSLSTPPPAEAASPSSAALWLASKSNEEAANGSQLNQFGIPK
SPGDGAAKLGSDGRKVARTSCMLFGFSLTEKMLPTEEDCAKEGSHEADCQNPRMLDLFGY
NRATPGALHALCAAPLGI
Download sequence
Identical sequences R7WA27
EMT18418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]