SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7WAA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7WAA7
Domain Number 1 Region: 23-87
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000235
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7WAA7
Sequence length 123
Comment (tr|R7WAA7|R7WAA7_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT14989.1, ECO:0000313|EnsemblPlants:EMT14989} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_22546 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MAASFIINWSCPDLLCFLRRTVQIIPTHFQRRLPARRAAVVLRCRGSSWILSYCGDTKLK
RLDQGWEDFAVHNRLQVGDACVFELVSGYAGDGGKREVVACRSPRISPPKETPPTSPSWT
SHP
Download sequence
Identical sequences R7WAA7
EMT14989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]