SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7WD09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7WD09
Domain Number 1 Region: 76-171
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-23
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 280-382
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-19
Family B3 DNA binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7WD09
Sequence length 388
Comment (tr|R7WD09|R7WD09_AEGTA) Putative B3 domain-containing protein {ECO:0000313|EMBL:EMT19908.1, ECO:0000313|EnsemblPlants:EMT19908} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_23597 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MPLGPAVVDVSDATPHLLHEHHMLPLVPSPPHAFPLHSQPSPKAPDDTFRKEMSKPWMKH
KELDEHRYRNHTGEQDKNFFKVMIGDFHERMIIPDKFAQHFRGQIGRTIKLASRHGYTSD
VQITKNLAKLVLDSGWKAFARAHNLRTGDFLVFKYDGNSELKVLIFGPSGCEKLPVCNLM
KNAAPGKDWWGNTDDIVNTCHDPPMKFPHCGRQIRPSMDSSRQGNDIINVSSSSSASDSA
GGISSSEDDLSLPGCILANGTLLNLNQVQKKQLKEKVRAMNSEVPIYGCVIRKSSIYGAT
RSLDISRKYAEVYLPFKEQMLTLQLHGKKWEVRCRVKNNKTKRLMRGWKHFARGNSLWLG
DVCLFELLRNKKKYVMNLHIIRKSLYKR
Download sequence
Identical sequences R7WD09
EMT19908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]