SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R8CJ41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8CJ41
Domain Number 1 Region: 60-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.3e-82
Family L-arabinose binding protein-like 0.0000136
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.04e-18
Family GalR/LacI-like bacterial regulator 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8CJ41
Sequence length 323
Comment (tr|R8CJ41|R8CJ41_BACCE) Ribose operon repressor {ECO:0000313|EMBL:EOO11612.1} KW=Complete proteome OX=1053205 OS=Bacillus cereus HuA3-9. GN=IGA_05474 OC=Bacillus cereus group.
Sequence
MSTIKDVAKLAGVSVATVSRVLNKNGYVHEDTLKKVERAIEMLDYKPSTVARSLYNKKSR
LIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDENLEKEKQYIDVLRQNNVDGFI
VATNPQNSVNYMNLSIPVVAIDRMFNERIPTVYADNYAGSQAATKLLIDKGCKHIAHIRG
PRDVSTANERFEGFVDVITQNNLSYMIAESTFDPANSEQVAVELLEEYPHIDGIVAGNDL
IAIGIVKAALQKGISIPNDLQIIGFDGISLTEMMYPSITTVAQPIYEMGKIATELLLEQM
EGNPLEEKHYRLPIEIIERNTTK
Download sequence
Identical sequences A0A0A0WUE9 A0A243AK61 A9VEU4 C2SFI3 C2XPF8 J7T2H1 J8CP42 J9CU88 R8CJ41 R8CR20 R8HPE3
WP_002029805.1.17940 WP_002029805.1.30061 WP_002029805.1.39317 WP_002029805.1.4496 WP_002029805.1.47957 WP_002029805.1.50411 WP_002029805.1.52845 WP_002029805.1.57105 WP_002029805.1.64566 WP_002029805.1.68668 WP_002029805.1.76817 WP_002029805.1.85012 WP_002029805.1.99908 gi|163938587|ref|YP_001643471.1| 315730.BcerKBAB4_0578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]