SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R8H964 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8H964
Domain Number 1 Region: 51-183
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.75e-25
Family Probable transcriptional regulator VC1968, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.83e-16
Family Probable transcriptional regulator VC1968, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8H964
Sequence length 185
Comment (tr|R8H964|R8H964_BACCE) Transcriptional regulator {ECO:0000313|EMBL:EOO69415.1} KW=Complete proteome OX=1053243 OS=Bacillus cereus VD196. GN=IKE_01349 OC=Bacillus cereus group.
Sequence
MEEIQLILAKNLKLIREKEKLSLEKVSQLTGVSKTMIGQIERGDSSPTLTTIWKIANGLK
VSFTSLINNPQPDTKVVLRNDVQVLSEDNGRYKVYPSFPFQDNRNFEIYMVEIDTEGKLS
SEAHKEGTEEFITVFEGKLTIDINDCQYTLNNGDSIRFKADRPHTYTNSGRTLTRLSMTI
YYPAL
Download sequence
Identical sequences A0A1M6K4W3 A0A243DWV4 R8H964
gi|296502971|ref|YP_003664671.1| WP_000391289.1.14176 WP_000391289.1.19438 WP_000391289.1.25599 WP_000391289.1.32927 WP_000391289.1.41464 WP_000391289.1.41518 WP_000391289.1.60153 WP_000391289.1.6304 WP_000391289.1.6846 WP_000391289.1.71114 WP_000391289.1.85592 WP_000391289.1.96437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]