SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R8HKP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8HKP7
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.68e-44
Family Zn metallo-beta-lactamase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R8HKP7
Sequence length 240
Comment (tr|R8HKP7|R8HKP7_BACCE) Metal-dependent hydrolase {ECO:0000313|EMBL:EOO73498.1} KW=Complete proteome OX=1053224 OS=Bacillus cereus VD021. GN=IIC_03710 OC=Bacillus cereus group.
Sequence
MRMMHEKTVYQLSFLPRVFPVNCYFVEEEDGLTLIDAALPYSTKGILQAAEKIGKPITKI
VLTHAHDDHIGALDALKEVLPNVPVYISKRDAKLLEGDTTLQKDEPNIPIKGGVPKKVKT
VPDVLLEDGDRVGSLLAIMTPGHTPGSMSLLDVRNKALIVGDAFQTRGGMAVSGQMKFWF
PFPAMATWSKEISLQSAEKLSEYEPSLLAAGHGKMIKDPGTVIKLAIKEAKRNIESRKEG
Download sequence
Identical sequences A9VP11 J8BX32 R8HKP7
WP_002143649.1.17940 WP_002143649.1.85012 WP_002143649.1.99908 gi|163942724|ref|YP_001647608.1| 315730.BcerKBAB4_4832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]