SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R8KVU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8KVU3
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.78e-35
Family Ribosomal protein L6 0.0000112
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.8e-27
Family Ribosomal protein L6 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8KVU3
Sequence length 179
Comment (tr|R8KVU3|R8KVU3_BACCE) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome OX=1053218 OS=Bacillus cereus MC118. GN=II1_03084 OC=Bacillus cereus group.
Sequence
MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFKTDMSIKIEENTLTVERPSEQK
EHRALHGTTRALIGNMVEGVTTGFARGLELVGVGYRAQKQGDKLVLSVGYSHPVEMTPEA
GLEVEVPVPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGIRYEGEVVRRKEGKTAK
Download sequence
Identical sequences A0A1C3Z1H3 A0A1S9S3J2 A9VP92 C2XN91 J7X2U4 J8CSP1 J8D3M9 J8FKN5 J8ZX92 R8CFV6 R8CJK7 R8KVU3 R8R0U0
gi|163938133|ref|YP_001643017.1| 315730.BcerKBAB4_0120 WP_002063425.1.100215 WP_002063425.1.100479 WP_002063425.1.10775 WP_002063425.1.23136 WP_002063425.1.27138 WP_002063425.1.38270 WP_002063425.1.39317 WP_002063425.1.42272 WP_002063425.1.45835 WP_002063425.1.50487 WP_002063425.1.53672 WP_002063425.1.53916 WP_002063425.1.65665 WP_002063425.1.66471 WP_002063425.1.67742 WP_002063425.1.68668 WP_002063425.1.72824 WP_002063425.1.73166 WP_002063425.1.75300 WP_002063425.1.76817 WP_002063425.1.84520 WP_002063425.1.84599 WP_002063425.1.85012 WP_002063425.1.89263 WP_002063425.1.89564 WP_002063425.1.89932 WP_002063425.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]