SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R8N8D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8N8D0
Domain Number 1 Region: 60-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.17e-72
Family L-arabinose binding protein-like 0.000016
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.51e-17
Family GalR/LacI-like bacterial regulator 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8N8D0
Sequence length 337
Comment (tr|R8N8D0|R8N8D0_BACCE) LacI family transcription regulator {ECO:0000313|EMBL:EOP42574.1} KW=Complete proteome OX=1053236 OS=Bacillus cereus VD146. GN=IK1_00386 OC=Bacillus cereus group.
Sequence
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTE
TIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGII
LCSLENPWENVEPYLQHGPIVLCNEYIEEANVPTVKFDHAQGAYIAANHVLEQGYRNLIF
CRGNETKVVSQQRKMGFLRAITEKSREVEAIDFLENAFSWDDGKRIFNEVLKDKKNPTAI
LAGGDEVAAGIISEAKRHGWSIPEDLAVIGFDNQILAQITEPGITTIEQPIDEMARKVVD
LMMDKIHTKNYRQKELYEFELELLVKGSTMKDTMLLA
Download sequence
Identical sequences A0A084J4K1 A0A150C2J5 A0A1I5ZBU8 A0A243AL36 A9VIB2 J7X0A8 J8DBM6 J8EFZ1 J8ICA8 J8NRQ8 J8NXH5 J8P2S2 J9CUT5 R8CT66 R8EYG2 R8N8D0 W4E8T6
WP_002087115.1.10033 WP_002087115.1.100646 WP_002087115.1.100649 WP_002087115.1.11324 WP_002087115.1.20051 WP_002087115.1.20881 WP_002087115.1.21695 WP_002087115.1.22507 WP_002087115.1.27729 WP_002087115.1.27732 WP_002087115.1.28299 WP_002087115.1.2902 WP_002087115.1.2904 WP_002087115.1.30061 WP_002087115.1.31050 WP_002087115.1.35095 WP_002087115.1.36226 WP_002087115.1.37635 WP_002087115.1.37649 WP_002087115.1.37801 WP_002087115.1.38645 WP_002087115.1.39255 WP_002087115.1.39896 WP_002087115.1.4354 WP_002087115.1.4496 WP_002087115.1.46157 WP_002087115.1.47674 WP_002087115.1.47957 WP_002087115.1.50411 WP_002087115.1.52845 WP_002087115.1.54007 WP_002087115.1.57105 WP_002087115.1.59016 WP_002087115.1.60236 WP_002087115.1.63476 WP_002087115.1.6426 WP_002087115.1.64566 WP_002087115.1.68186 WP_002087115.1.68668 WP_002087115.1.72867 WP_002087115.1.75292 WP_002087115.1.79293 WP_002087115.1.82832 WP_002087115.1.8290 WP_002087115.1.85012 WP_002087115.1.85187 WP_002087115.1.86789 WP_002087115.1.87416 WP_002087115.1.93582 WP_002087115.1.99044 WP_002087115.1.99558 WP_002087115.1.99908 gi|163938999|ref|YP_001643883.1| 315730.BcerKBAB4_1003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]